Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50265405 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_497294 (CHEMBL995856) |
---|
Ki | 113±n/a nM |
---|
Citation | Mercer, SL; Shaikh, J; Traynor, JR; Matsumoto, RR; Coop, A Nitrile analogs of meperidine as high affinity and selective sigma-1 receptor ligands. Eur J Med Chem43:1304-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50265405 |
---|
n/a |
---|
Name | BDBM50265405 |
Synonyms: | 1-Methyl-4-phenylpiperidine-4-carbonitrile | CHEMBL495954 |
Type | Small organic molecule |
Emp. Form. | C13H16N2 |
Mol. Mass. | 200.2795 |
SMILES | CN1CCC(CC1)(C#N)c1ccccc1 |
Structure |
|