| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50265407 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_497294 (CHEMBL995856) |
|---|
| Ki | 1.7±n/a nM |
|---|
| Citation |  Mercer, SL; Shaikh, J; Traynor, JR; Matsumoto, RR; Coop, A Nitrile analogs of meperidine as high affinity and selective sigma-1 receptor ligands. Eur J Med Chem43:1304-8 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50265407 |
|---|
| n/a |
|---|
| Name | BDBM50265407 |
|---|
| Synonyms: | 1-Propyl-4-phenylpiperidine-4-carbonitrile | CHEMBL473112 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H20N2 |
|---|
| Mol. Mass. | 228.3327 |
|---|
| SMILES | CCCN1CCC(CC1)(C#N)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
