Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2C9
LigandBDBM50158460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_529685
Ki 19±n/a nM
Citation Peng CCRushmore TCrouch GJJones JP Modeling and synthesis of novel tight-binding inhibitors of cytochrome P450 2C9. Bioorg Med Chem 16:4064-74 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2C9
Name:Cytochrome P450 2C9
Synonyms:(R)-limonene 6-monooxygenase | (S)-limonene 6-monooxygenase | CYPIIC9 | Cytochrome P450 1A2 (CYP1A2) | Cytochrome P450 2C9 (CYP2C9 ) | Cytochrome P450 2C9 (CYP2C9) | P-450MP | P450 MP-4/MP-8 | P450 PB-1 | S-mephenytoin 4-hydroxylase
Type:Enzyme
Mol. Mass.:55636.33
Organism:Homo sapiens (Human)
Description:P11712
Residue:490
Sequence:
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158460
n/a
NameBDBM50158460
Synonyms:(3,5-dibromo-4-hydroxyphenyl)(2-ethyl-1-benzofuran-3-yl)methanone | 2-ethyl-3-(3,5-dibrom-4-hydroxybenzoyl)benzofuran | 3,5-dibromo-4-hydroxyphenyl-2-ethyl-3-benzofuranyl ketone | Benzbromarone | CHEMBL388590 | US9725430, Compound 1 | Uroleap (TN) | cid_2333
TypeSmall organic molecule
Emp. Form.C17H12Br2O3
Mol. Mass.424.083
SMILESCCc1oc2ccccc2c1C(=O)c1cc(Br)c(O)c(Br)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: