Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin releasing hormone 1 (GnRHR1)
LigandBDBM50166441
Substrate/Competitorn/a
Meas. Tech.ChEMBL_555922
Ki 0.45±n/a nM
Citation Betz SFZhu YFChen CStruthers RS Non-peptide gonadotropin-releasing hormone receptor antagonists. J Med Chem 51:3331-48 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin releasing hormone 1 (GnRHR1)
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH)
Type:Enzyme
Mol. Mass.:37749.45
Organism:Homo sapiens (Human)
Description:P30968
Residue:328
Sequence:
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166441
n/a
NameBDBM50166441
Synonyms:(R)-1-(2-fluoro-6-(trifluoromethyl)benzyl)-3-(2-amino-2-phenylethyl)-5-(2-chloro-3-methoxyphenyl)pyrimidine-2,4(1H,3H)-dione | 3-((R)-2-Amino-2-phenyl-ethyl)-5-(2-chloro-3-methoxy-phenyl)-1-(2-fluoro-6-trifluoromethyl-benzyl)-1H-pyrimidine-2,4-dione | CHEMBL192955
TypeSmall organic molecule
Emp. Form.C27H22ClF4N3O3
Mol. Mass.547.928
SMILESCOc1cccc(c1Cl)-c1cn(Cc2c(F)cccc2C(F)(F)F)c(=O)n(C[C@H](N)c2ccccc2)c1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: