| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gonadotropin-releasing hormone receptor |
|---|
| Ligand | BDBM50098391 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_555946 (CHEMBL959130) |
|---|
| IC50 | 7±n/a nM |
|---|
| Citation |  Betz, SF; Zhu, YF; Chen, C; Struthers, RS Non-peptide gonadotropin-releasing hormone receptor antagonists. J Med Chem51:3331-48 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gonadotropin-releasing hormone receptor |
|---|
| Name: | Gonadotropin-releasing hormone receptor |
|---|
| Synonyms: | GNRHR | GNRHR_MACMU |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 7087.59 |
|---|
| Organism: | Macaca mulatta |
|---|
| Description: | ChEMBL_495156 |
|---|
| Residue: | 59 |
|---|
| Sequence: | VAFATSFTVCWTPYYVLGIWYWFDPEMLNRVSDPVNHFFFLFAFLNPCFDPLIYGYFSL
|
|
|
|---|
| BDBM50098391 |
|---|
| n/a |
|---|
| Name | BDBM50098391 |
|---|
| Synonyms: | (S)-4-(2-(azetidin-2-yl)ethoxy)-7-chloro-2-oxo-N-(pyrimidin-4-yl)-3-(3,4,5-trimethylphenyl)-1,2-dihydroquinoline-6-carboxamide | 4-((S)-2-Azetidin-2-yl-ethoxy)-7-chloro-2-oxo-3-(3,4,5-trimethyl-phenyl)-1,2-dihydro-quinoline-6-carboxylic acid pyrimidin-4-ylamide | 4-(2-Azetidin-2-yl-ethoxy)-7-chloro-2-oxo-3-(3,4,5-trimethyl-phenyl)-1,2-dihydro-quinoline-6-carboxylic acid pyrimidin-4-ylamide | CHEMBL120432 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H28ClN5O3 |
|---|
| Mol. Mass. | 518.007 |
|---|
| SMILES | Cc1cc(cc(C)c1C)-c1c(OCC[C@@H]2CCN2)c2cc(C(=O)Nc3ccncn3)c(Cl)cc2[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
