| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nociceptin receptor |
|---|
| Ligand | BDBM50260632 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_556065 (CHEMBL953418) |
|---|
| IC50 | 18±n/a nM |
|---|
| Citation |  Okamoto, O; Kobayashi, K; Kawamoto, H; Ito, S; Yoshizumi, T; Yamamoto, I; Hashimoto, M; Shimizu, A; Takahashi, H; Ishii, Y; Ozaki, S; Ohta, H Novel ORL1-selective antagonists with oral bioavailability and brain penetrability. Bioorg Med Chem Lett18:3282-5 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nociceptin receptor |
|---|
| Name: | Nociceptin receptor |
|---|
| Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40702.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41146 |
|---|
| Residue: | 370 |
|---|
| Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
|---|
| BDBM50260632 |
|---|
| n/a |
|---|
| Name | BDBM50260632 |
|---|
| Synonyms: | 2-((1S,4S)-5-(6-chloro-2-(pentan-3-ylthio)-3H-benzo[d]imidazol-5-yl)-2,5-diaza-bicyclo[2.2.1]heptan-2-yl)ethanol | CHEMBL523724 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27ClN4OS |
|---|
| Mol. Mass. | 394.962 |
|---|
| SMILES | CCC(CC)Sc1nc2cc(Cl)c(cc2[nH]1)N1C[C@@H]2C[C@H]1CN2CCO |r| |
|---|
| Structure | 
|
|---|
Search and Browse
