Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamine synthetase
LigandBDBM50260535
Substrate/Competitorn/a
Meas. Tech.ChEMBL_555756
Ki 40000±n/a nM
Citation Nordqvist ANilsson MTRöttger SOdell LRKrajewski WWEvalena Andersson CLarhed MMowbray SLKarlén A Evaluation of the amino acid binding site of Mycobacterium tuberculosis glutamine synthetase for drug discovery. Bioorg Med Chem 16:5501-13 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamine synthetase
Name:Glutamine synthetase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51775.05
Organism:Salmonella typhimurium
Description:ChEMBL_555756
Residue:469
Sequence:
MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKG
INESDMVLMPDASTAVIDPFFADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATG
IADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGGY
FPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYK
YVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIG
GVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVR
FPDPAANPYLCFAALLMAGLDGIKNKIHPGEAMDKNLYDLPPEEAKEIPQVAGSLEEALN
ALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50260535
n/a
NameBDBM50260535
Synonyms:(2S,5R)-2,6-diamino-5-hydroxyhexanoic acid | (2S,5R)-5-hydroxylysine | CHEMBL457104 | L-normal-5-hydroxylysine | erythro-5-hydroxy-L-lysine
TypeSmall organic molecule
Emp. Form.C6H14N2O3
Mol. Mass.162.187
SMILESNC[C@H](O)CC[C@H](N)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: