Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamine synthetase
LigandBDBM50260541
Substrate/Competitorn/a
Meas. Tech.ChEMBL_555758
Ki 21000±n/a nM
Citation Nordqvist ANilsson MTRöttger SOdell LRKrajewski WWEvalena Andersson CLarhed MMowbray SLKarlén A Evaluation of the amino acid binding site of Mycobacterium tuberculosis glutamine synthetase for drug discovery. Bioorg Med Chem 16:5501-13 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamine synthetase
Name:Glutamine synthetase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39098.57
Organism:Glycine max
Description:ChEMBL_555758
Residue:355
Sequence:
MSLLSDLINLNLSDITDKVIAEYIWVGGSGMDMRSKARTLPGPVRDPSGLPKWNYDGSST
GQAPGEDSEVIYIHKPFQDPFRRGSNILVMCDAYTPAGEPIPTNKRNNAAKIFGHPDVAA
EEPWYGIKQEYTLLQKDVQWPLGWPLGGFLGHKGPYYCGTGANKAFGRDIVDSHYKACIY
AGFNISGMNPEVMPGQWEFQVGPSIGISAADELWEARYILERISEIAGVVLSFDPKPIPG
DWNGAGAHTNYSTKSMRDDGGYEVIKAAIAKLEKRHKEHIAAYGEGNERRLTGHDETADM
NSLLWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50260541
n/a
NameBDBM50260541
Synonyms:CHEMBL452711 | L-2-Amino-4-hydroxyaminobutyric acid
TypeSmall organic molecule
Emp. Form.C4H10N2O3
Mol. Mass.134.1338
SMILESN[C@@H](CCNO)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: