Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 1
LigandBDBM50271765
Substrate/Competitorn/a
Meas. Tech.ChEMBL_556424
Ki 13470±n/a nM
Citation Fells JITsukahara RFujiwara YLiu JPerygin DHOsborne DATigyi GParrill AL Identification of non-lipid LPA3 antagonists by virtual screening. Bioorg Med Chem 16:6207-17 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 1
Name:Lysophosphatidic acid receptor 1
Synonyms:LPA receptor 1 | LPA-1 | LPAR1 | Lysophosphatidic acid receptor 1 (LPA1) | Lysophosphatidic acid receptor Edg-2
Type:Enzyme
Mol. Mass.:41120.55
Organism:Homo sapiens (Human)
Description:Q92633
Residue:364
Sequence:
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50271765
n/a
NameBDBM50271765
Synonyms:3-(4-{3-[4-(3-Carboxy-acryloylamino)-phenoxy]-phenoxy}-phenylcarbamoyl)-acrylic acid | 4,4'-(4,4'-(1,3-phenylenebis(oxy))bis(4,1-phenylene))bis(azanediyl)bis(4-oxobut-2-enoic acid) | CHEMBL482498
TypeSmall organic molecule
Emp. Form.C26H20N2O8
Mol. Mass.488.4456
SMILESOC(=O)\C=C\C(=O)Nc1ccc(Oc2cccc(Oc3ccc(NC(=O)\C=C\C(O)=O)cc3)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: