Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin E
LigandBDBM50271627
Substrate/Competitorn/a
Meas. Tech.ChEMBL_556483
Ki 2±n/a nM
Citation Cumming JNLe TXBabu SCarroll CChen XFavreau LGaspari PGuo THobbs DWHuang YIserloh UKennedy MEKuvelkar RLi GLowrie JMcHugh NAOzgur LPan JParker EMSaionz KStamford AWStrickland CTadesse DVoigt JWang LWu YZhang LZhang Q Rational design of novel, potent piperazinone and imidazolidinone BACE1 inhibitors. Bioorg Med Chem Lett 18:3236-41 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin E
Name:Cathepsin E
Synonyms:n/a
Type:Enzyme
Mol. Mass.:43298.99
Organism:Homo sapiens (Human)
Description:P14091
Residue:401
Sequence:
MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESC
SMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRF
QPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSAFATQVEGLTVVGQQFGESVTEPGQT
FVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGG
YDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIK
QLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGF
QGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50271627
n/a
NameBDBM50271627
Synonyms:CHEMBL507651 | N'-[(1S,2S)-2-[(4S)-1-benzyl-5-oxoimidazolidin-4-yl]-1-(3,5-difluorobenzyl)-2-hydroxyethyl]-5-methyl-N,N-dipropylbenzene-1,3-dicarboxamide | N1-((1S,2S)-1-((S)-1-benzyl-5-oxoimidazolidin-4-yl)-3-(3,5-difluorophenyl)-1-hydroxypropan-2-yl)-5-methyl-N3,N3-dipropylisophthalamide
TypeSmall organic molecule
Emp. Form.C34H40F2N4O4
Mol. Mass.606.7026
SMILESCCCN(CCC)C(=O)c1cc(C)cc(c1)C(=O)N[C@@H](Cc1cc(F)cc(F)c1)[C@H](O)[C@@H]1NCN(Cc2ccccc2)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: