Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B
LigandBDBM10755
Substrate/Competitorn/a
Meas. Tech.ChEMBL_552731
Ki 1.1±n/a nM
Citation Choi SKGreen DHo AKlein UMarquess DTaylor RTurner SD Designing selective, high affinity ligands of 5-HT1D receptor by covalent dimerization of 5-HT1F ligands derived from 4-fluoro-N-[3-(1-methyl-4-piperidinyl)-1H-indol-5-yl]benzamide. J Med Chem 51:3609-16 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1B
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | S12 | Serotonin 1D beta receptor | Serotonin Receptor 1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:43579.17
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells
Residue:390
Sequence:
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: