Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50244319
Substrate/Competitorn/a
Meas. Tech.ChEMBL_554821
EC50 1.3±n/a nM
Citation Pagé DBalaux EBoisvert LLiu ZMilburn CTremblay MWei ZWoo SLuo XCheng YXYang HSrivastava SZhou FBrown WTomaszewski MWalpole CHodzic LSt-Onge SGodbout CSalois DPayza KPayza K Novel benzimidazole derivatives as selective CB2 agonists. Bioorg Med Chem Lett 18:3695-700 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244319
n/a
NameBDBM50244319
Synonyms:1-adamantan-1-ylmethyl-2-(4-ethoxy-benzyl)-1H-benzoimidazole-5-carboxylic acid diethylamide | CHEMBL511134
TypeSmall organic molecule
Emp. Form.C32H41N3O2
Mol. Mass.499.6868
SMILESCCOc1ccc(Cc2nc3cc(ccc3n2CC23CC4CC(CC(C4)C2)C3)C(=O)N(CC)CC)cc1 |THB:19:20:23:27.18.26,19:18:21.20.25:23,26:18:21:25.24.23,26:24:21:27.19.18|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: