Reaction Details |
| Report a problem with these data |
Target | Urotensin-2 receptor |
---|
Ligand | BDBM50243921 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_555221 (CHEMBL965358) |
---|
Ki | 20±n/a nM |
---|
Citation | McAtee, JJ; Dodson, JW; Dowdell, SE; Erhard, K; Girard, GR; Goodman, KB; Hilfiker, MA; Jin, J; Sehon, CA; Sha, D; Shi, D; Wang, F; Wang, GZ; Wang, N; Wang, Y; Viet, AQ; Yuan, CC; Zhang, D; Aiyar, NV; Behm, DJ; Carballo, LH; Evans, CA; Fries, HE; Nagilla, R; Roethke, TJ; Xu, X; Douglas, SA; Neeb, MJ Potent and selective small-molecule human urotensin-II antagonists with improved pharmacokinetic profiles. Bioorg Med Chem Lett18:3716-9 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Urotensin-2 receptor |
---|
Name: | Urotensin-2 receptor |
Synonyms: | G-protein coupled receptor 14 | GPR14 | UR-II-R | UR2R_HUMAN | UTS2R | Urotensin II receptor | Urotensin-II |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 42159.71 |
Organism: | Homo sapiens (Human) |
Description: | Urotensin-II UTS2R HUMAN::Q9UKP6 |
Residue: | 389 |
Sequence: | MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA
MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD
VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL
TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR
SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT
TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS
SCSPQPTDSLVLAPAAPARPAPEGPRAPA
|
|
|
BDBM50243921 |
---|
n/a |
---|
Name | BDBM50243921 |
Synonyms: | CHEMBL488642 | N-(1-Biphenyl-4-yl-2-pyrrolidin-1-yl-ethyl)-2-[(3,4-dichloro-phenyl)-methyl-amino]-N-methyl-acetamide |
Type | Small organic molecule |
Emp. Form. | C28H31Cl2N3O |
Mol. Mass. | 496.471 |
SMILES | CN(CC(=O)N(C)C(CN1CCCC1)c1ccc(cc1)-c1ccccc1)c1ccc(Cl)c(Cl)c1 |
Structure |
|