| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Urotensin-2 receptor |
|---|
| Ligand | BDBM50244019 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_555221 (CHEMBL965358) |
|---|
| Ki | 3±n/a nM |
|---|
| Citation |  McAtee, JJ; Dodson, JW; Dowdell, SE; Erhard, K; Girard, GR; Goodman, KB; Hilfiker, MA; Jin, J; Sehon, CA; Sha, D; Shi, D; Wang, F; Wang, GZ; Wang, N; Wang, Y; Viet, AQ; Yuan, CC; Zhang, D; Aiyar, NV; Behm, DJ; Carballo, LH; Evans, CA; Fries, HE; Nagilla, R; Roethke, TJ; Xu, X; Douglas, SA; Neeb, MJ Potent and selective small-molecule human urotensin-II antagonists with improved pharmacokinetic profiles. Bioorg Med Chem Lett18:3716-9 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Urotensin-2 receptor |
|---|
| Name: | Urotensin-2 receptor |
|---|
| Synonyms: | G-protein coupled receptor 14 | GPR14 | UR-II-R | UR2R_HUMAN | UTS2R | Urotensin II receptor | Urotensin-II |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 42159.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Urotensin-II UTS2R HUMAN::Q9UKP6 |
|---|
| Residue: | 389 |
|---|
| Sequence: | MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA
MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD
VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL
TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR
SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT
TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS
SCSPQPTDSLVLAPAAPARPAPEGPRAPA
|
|
|
|---|
| BDBM50244019 |
|---|
| n/a |
|---|
| Name | BDBM50244019 |
|---|
| Synonyms: | 4'-[1-({2-[(3,4-Dichloro-phenyl)-(2-methoxy-ethyl)-amino]-acetyl}-methyl-amino)-2-pyrrolidin-1-yl-ethyl]-biphenyl-4-carboxylic acid amide | CHEMBL453067 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H36Cl2N4O3 |
|---|
| Mol. Mass. | 583.549 |
|---|
| SMILES | COCCN(CC(=O)N(C)C(CN1CCCC1)c1ccc(cc1)-c1ccc(cc1)C(N)=O)c1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
