Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOpioid receptors; mu/kappa/delta
LigandBDBM50244021
Substrate/Competitorn/a
Meas. Tech.ChEMBL_555222
EC50 2000±n/a nM
Citation McAtee JJDodson JWDowdell SEErhard KGirard GRGoodman KBHilfiker MAJin JSehon CASha DShi DWang FWang GZWang NWang YViet AQYuan CCZhang DAiyar NVBehm DJCarballo LHEvans CAFries HENagilla RRoethke TJXu XDouglas SANeeb MJ Potent and selective small-molecule human urotensin-II antagonists with improved pharmacokinetic profiles. Bioorg Med Chem Lett 18:3716-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Opioid receptors; mu/kappa/delta
Name:Opioid receptors; mu/kappa/delta
Synonyms:K-OR-1 | KOR-1 | Kappa-opioid receptor (KOR) | Kappa-type opioid receptor (KOPR) | Kappa-type opioid receptor (KOR) | Kappa-type opioid receptor (Kappa) | OPIATE Kappa | OPRK | OPRK1 | kappa opioid receptor (KOR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42648.76
Organism:Homo sapiens (Human)
Description:P41145
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244021
n/a
NameBDBM50244021
Synonyms:4'-(1-{[2-(6,7-Dichloro-2-oxo-2H-quinoxalin-1-yl)-acetyl]-methyl-amino}-2-morpholin-4-yl-ethyl)-biphenyl-3-carboxylic acid methylamide | CHEMBL507691
TypeSmall organic molecule
Emp. Form.C31H31Cl2N5O4
Mol. Mass.608.515
SMILESCNC(=O)c1cccc(c1)-c1ccc(cc1)C(CN1CCOCC1)N(C)C(=O)Cn1c2cc(Cl)c(Cl)cc2ncc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: