Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 2-associated protein 1 |
---|
Ligand | BDBM50243099 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_491562 (CHEMBL944208) |
---|
IC50 | 8400±n/a nM |
---|
Citation | Janetka, JW; Almeida, L; Ashwell, S; Brassil, PJ; Daly, K; Deng, C; Gero, T; Glynn, RE; Horn, CL; Ioannidis, S; Lyne, P; Newcombe, NJ; Oza, VB; Pass, M; Springer, SK; Su, M; Toader, D; Vasbinder, MM; Yu, D; Yu, Y; Zabludoff, SD Discovery of a novel class of 2-ureido thiophene carboxamide checkpoint kinase inhibitors. Bioorg Med Chem Lett18:4242-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 2-associated protein 1 |
---|
Name: | Cyclin-dependent kinase 2-associated protein 1 |
Synonyms: | CDK2AP1 | CDKA1_HUMAN | CDKAP1 | DOC1 |
Type: | PROTEIN |
Mol. Mass.: | 12370.40 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_491562 |
Residue: | 115 |
Sequence: | MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQ
SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
|
|
|
BDBM50243099 |
---|
n/a |
---|
Name | BDBM50243099 |
Synonyms: | (S)-1-(5-(4-(dimethylamino)phenyl)-3-(piperidin-3-ylcarbamoyl)thiophen-2-yl)urea | CHEMBL488287 |
Type | Small organic molecule |
Emp. Form. | C19H25N5O2S |
Mol. Mass. | 387.499 |
SMILES | CN(C)c1ccc(cc1)-c1cc(C(=O)N[C@H]2CCCNC2)c(NC(N)=O)s1 |r| |
Structure |
|