Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50243005 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_492375 (CHEMBL948371) |
---|
Ki | 5.8±n/a nM |
---|
Citation | Fookes, CJ; Pham, TQ; Mattner, F; Greguric, I; Loc'h, C; Liu, X; Berghofer, P; Shepherd, R; Gregoire, MC; Katsifis, A Synthesis and biological evaluation of substituted [18F]imidazo[1,2-a]pyridines and [18F]pyrazolo[1,5-a]pyrimidines for the study of the peripheral benzodiazepine receptor using positron emission tomography. J Med Chem51:3700-12 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50243005 |
---|
n/a |
---|
Name | BDBM50243005 |
Synonyms: | 2-(6-Chloro-2-(4-(2-fluoroethoxy)phenyl)imidazo[1,2-a]pyridin-3-yl)-N,N-diethylacetamide | CHEMBL469680 |
Type | Small organic molecule |
Emp. Form. | C21H23ClFN3O2 |
Mol. Mass. | 403.878 |
SMILES | CCN(CC)C(=O)Cc1c(nc2ccc(Cl)cn12)-c1ccc(OCCF)cc1 |
Structure |
|