| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50243005 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_492376 (CHEMBL948372) |
|---|
| Ki | 3.3±n/a nM |
|---|
| Citation |  Fookes, CJ; Pham, TQ; Mattner, F; Greguric, I; Loc'h, C; Liu, X; Berghofer, P; Shepherd, R; Gregoire, MC; Katsifis, A Synthesis and biological evaluation of substituted [18F]imidazo[1,2-a]pyridines and [18F]pyrazolo[1,5-a]pyrimidines for the study of the peripheral benzodiazepine receptor using positron emission tomography. J Med Chem51:3700-12 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50243005 |
|---|
| n/a |
|---|
| Name | BDBM50243005 |
|---|
| Synonyms: | 2-(6-Chloro-2-(4-(2-fluoroethoxy)phenyl)imidazo[1,2-a]pyridin-3-yl)-N,N-diethylacetamide | CHEMBL469680 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23ClFN3O2 |
|---|
| Mol. Mass. | 403.878 |
|---|
| SMILES | CCN(CC)C(=O)Cc1c(nc2ccc(Cl)cn12)-c1ccc(OCCF)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
