Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50252420 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_487721 (CHEMBL1009453) |
---|
Ki | 439±n/a nM |
---|
Citation | Keresztes, A; Szucs, M; Borics, A; Kövér, KE; Forró, E; Fülöp, F; Tömböly, C; Péter, A; Páhi, A; Fábián, G; Murányi, M; Tóth, G New endomorphin analogues containing alicyclic beta-amino acids: influence on bioactive conformation and pharmacological profile. J Med Chem51:4270-9 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50252420 |
---|
n/a |
---|
Name | BDBM50252420 |
Synonyms: | (1R,2R)-N-((S)-1-((S)-1-amino-1-oxo-3-phenylpropan-2-ylamino)-1-oxo-3-phenylpropan-2-yl)-2-((S)-2-amino-3-(4-hydroxyphenyl)propanamido)cyclohexanecarboxamide | CHEMBL447871 |
Type | Small organic molecule |
Emp. Form. | C34H41N5O5 |
Mol. Mass. | 599.7198 |
SMILES | N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H]1CCCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r| |
Structure |
|