Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine receptor (H3)
LigandBDBM50262585
Substrate/Competitorn/a
Meas. Tech.ChEMBL_489014
IC50 4.3±n/a nM
Citation Nagase TMizutani TIshikawa SSekino ESasaki TFujimura TIto SMitobe YMiyamoto YYoshimoto RTanaka TIshihara ATakenaga NTokita SFukami TSato N Synthesis, structure-activity relationships, and biological profiles of a quinazolinone class of histamine H3 receptor inverse agonists. J Med Chem 51:4780-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine receptor (H3)
Name:Histamine receptor (H3 and H4)
Synonyms:G-protein coupled receptor 97 | HH3R | HISTAMINE H3 | HRH3 | Histamine H3 Receptor | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48691.47
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH3R receptors.
Residue:445
Sequence:
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50262585
n/a
NameBDBM50262585
Synonyms:2-Methyl-3-[4-({3-[(2R)-2-methyl-1-pyrrolidinyl]propyl}oxy)phenyl]-4(3H)-quinazolinone | CHEMBL477361
TypeSmall organic molecule
Emp. Form.C23H27N3O2
Mol. Mass.377.4794
SMILESC[C@@H]1CCCN1CCCOc1ccc(cc1)-n1c(C)nc2ccccc2c1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: