Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 11
LigandBDBM50263093
Substrate/Competitorn/a
Meas. Tech.ChEMBL_490153
Ki 24±n/a nM
Citation Angell RAston NMBamborough PBuckton JBCockerill SdeBoeck SJEdwards CDHolmes DSJones KLLaine DIPatel SSmee PASmith KJSomers DOWalker AL Biphenyl amide p38 kinase inhibitors 3: Improvement of cellular and in vivo activity. Bioorg Med Chem Lett 18:4428-32 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 11
Name:Mitogen-activated protein kinase 11
Synonyms:MAP kinase p38 | Mitogen-activated protein kinase p38 beta | PRKM11 | SAPK2 | SAPK2B | Stress-activated protein kinase 2 | p38-2 | p38-beta | p38b
Type:Enzyme Catalytic Domain
Mol. Mass.:41351.73
Organism:Homo sapiens (Human)
Description:gi_20128774
Residue:364
Sequence:
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50263093
n/a
NameBDBM50263093
Synonyms:6-Methyl-biphenyl-3,4'-dicarboxylic acid 3-cyclopropylamide 4'-cyclopropylmethyl-amide | CHEMBL478649 | N3-cyclopropyl-N4'-(cyclopropylmethyl)-6-methylbiphenyl-3,4'-dicarboxamide | N~3~-cyclopropyl-N~4~'-(cyclopropylmethyl)-6-methylbiphenyl-3,4'-dicarboxamide
TypeSmall organic molecule
Emp. Form.C22H24N2O2
Mol. Mass.348.4382
SMILESCc1ccc(cc1-c1ccc(cc1)C(=O)NCC1CC1)C(=O)NC1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: