| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transcriptional activator protein LuxR |
|---|
| Ligand | BDBM50262517 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_490917 (CHEMBL989193) |
|---|
| IC50 | 6900±n/a nM |
|---|
| Citation |  Estephane, J; Dauvergne, J; Soulère, L; Reverchon, S; Queneau, Y; Doutheau, A N-Acyl-3-amino-5H-furanone derivatives as new inhibitors of LuxR-dependent quorum sensing: Synthesis, biological evaluation and binding mode study. Bioorg Med Chem Lett18:4321-4 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Transcriptional activator protein LuxR |
|---|
| Name: | Transcriptional activator protein LuxR |
|---|
| Synonyms: | LUXR_ALIFS | luxR |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28563.86 |
|---|
| Organism: | Vibrio fischeri |
|---|
| Description: | ChEMBL_831639 |
|---|
| Residue: | 250 |
|---|
| Sequence: | MKNINADDTYRIINKIKACRSNNDINQCLSDMTKMVHCEYYLLAIIYPHSMVKSDISILD
NYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLIT
GFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKSN
NDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILT
GAIDCPYFKN
|
|
|
|---|
| BDBM50262517 |
|---|
| n/a |
|---|
| Name | BDBM50262517 |
|---|
| Synonyms: | CHEMBL448263 | N-(4-chloro-2-oxo-2,5-dihydrofuran-3-yl)hexanamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H14ClNO3 |
|---|
| Mol. Mass. | 231.676 |
|---|
| SMILES | CCCCCC(=O)NC1=C(Cl)COC1=O |c:8| |
|---|
| Structure | 
|
|---|
Search and Browse
