Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-opioid receptor
LigandBDBM50272229
Substrate/Competitorn/a
Meas. Tech.ChEMBL_510434
IC50 1.21±n/a nM
Citation Balboni GFiorini SBaldisserotto ATrapella CSasaki YAmbo AMarczak EDLazarus LHSalvadori S Further studies on lead compounds containing the opioid pharmacophore Dmt-Tic. J Med Chem 51:5109-17 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-opioid receptor
Name:Mu-opioid receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:44729.40
Organism:Cavia porcellus
Description:ChEMBL_510437
Residue:400
Sequence:
MDSGAVPGNASDCTDPFAQSTCSPAPSPGSWTNLSHLDGNLSDPCGPNRTDLVGSDSLCP
PTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALAT
STLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDF
RTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRNGSIDCTLTFSHPTWYWENLLKICVFI
FAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHI
YVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTI
EQQNSTRIRQNTRDHPSTANTVDRTNHQLENLEAETAPLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50272229
n/a
NameBDBM50272229
Synonyms:CHEMBL444197 | H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid
TypeSmall organic molecule
Emp. Form.C31H33N5O5
Mol. Mass.555.6242
SMILESCc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2C[C@H]1C(=O)N[C@H](CC(O)=O)c1nc2ccccc2[nH]1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: