Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain-1
LigandBDBM50069792
Substrate/Competitorn/a
Meas. Tech.ChEMBL_512148
Ki 190±n/a nM
Citation Donkor IOKorukonda R Synthesis and calpain inhibitory activity of peptidomimetic compounds with constrained amino acids at the P2 position. Bioorg Med Chem Lett 18:4806-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calpain-1
Name:Calpain 1
Synonyms:CANP 1 | Calcium-activated neutral proteinase 1 | Calpain mu-type | Calpain-1 catalytic subunit | Calpain-1 large subunit | Micromolar-calpain | muCANP
Type:Catalytic subunit; forms a heterodimer with a small (regulatory) subunit (CAPNS1)
Mol. Mass.:81729.82
Organism:Sus scrofa (pig)
Description:Native calpain-1 from porcine erythrocytes, purchased from Calbiochem, was used in assay.
Residue:714
Sequence:
MAEEVITPVYCTGVSAQVQKLRAKELGLGRHENAIKYLGQDYEQLRAHCLQSGSLFRDEA
FPPVPQSLGFKELGPNSSKTYGVKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYSIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVNLIRMRNPWGE
VEWTGAWSDGSSEWNGVDPYQRDQLRVRMEDGEFWMSFRDFLREFTRLEICNLTPDALKS
QRVRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDPEDDYGGRESGCSF
VLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKKAGTQELDDQVQAILPDEQVLSE
EEIDENFKALFRQLAGEDMEISVRELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLFELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50069792
n/a
NameBDBM50069792
Synonyms:(2S)-2-[(2S)-2-acetamido-4-methylpentanamido]-N-[(1S)-1-formylpentyl]-4-methylpentanamide | Acetylleucyl-leucyl-norleucinal | CHEMBL304784 | N-acetylleucylleucylnorleucinal
TypeSmall organic molecule
Emp. Form.C20H37N3O4
Mol. Mass.383.5255
SMILESCCCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(C)=O)C=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: