Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein phosphatase non-receptor type 2
LigandBDBM50246745
Substrate/Competitorn/a
Meas. Tech.ChEMBL_557716
IC50 160±n/a nM
Citation Zhang YNZhang WHong DShi LShen QLi JYLi JHu LH Oleanolic acid and its derivatives: new inhibitor of protein tyrosine phosphatase 1B with cellular activities. Bioorg Med Chem 16:8697-705 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein phosphatase non-receptor type 2
Name:Tyrosine-protein phosphatase non-receptor type 2
Synonyms:T-cell protein tyrosine phosphatase (TCPTP) | T-cell protein-tyrosine phosphatase | TC-PTP | TCPTP | Tyrosine-protein phosphatase non-receptor type 2 (TC-PTP)
Type:Protein
Mol. Mass.:48481.80
Organism:Homo sapiens (Human)
Description:P17706
Residue:415
Sequence:
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50246745
n/a
NameBDBM50246745
Synonyms:3-(4-Carboxy-benzyloxy)-28-[4-butyric ((S)-1-carboxyphenylethyl)-amide]-Delta12-oleanene | CHEMBL499413
TypeSmall organic molecule
Emp. Form.C51H71NO6
Mol. Mass.794.1125
SMILESCC1(C)CC[C@]2(CCCCC(=O)N[C@@H](Cc3ccccc3)C(O)=O)CC[C@]3(C)C(=CC[C@@H]4[C@@]5(C)CC[C@H](OCc6ccc(cc6)C(O)=O)C(C)(C)[C@@H]5CC[C@@]34C)[C@@H]2C1 |r,c:29|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: