Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransketolase
LigandBDBM50263817
Substrate/Competitorn/a
Meas. Tech.ChEMBL_535726
IC50 3900±n/a nM
Citation Mao JEoh HHe RWang YWan BFranzblau SGCrick DCKozikowski AP Structure-activity relationships of compounds targeting mycobacterium tuberculosis 1-deoxy-D-xylulose 5-phosphate synthase. Bioorg Med Chem Lett 18:5320-3 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transketolase
Name:Transketolase
Synonyms:TK
Type:PROTEIN
Mol. Mass.:67886.43
Organism:Homo sapiens (Human)
Description:ChEMBL_468615
Residue:623
Sequence:
MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKS
QDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDV
ATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVA
ILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIA
KTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIAN
IRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEIFKKEHPDRFI
ECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS
IGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAII
YNNNEDFQVGQAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPL
DRKLILDSARATKGRILTVEDHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAE
LLKMFGIDRDAIAQAVRGLITKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50263817
n/a
NameBDBM50263817
Synonyms:5-benzyl-3-(4-chlorophenyl)pyrazolo[1,5-a]pyrimidin-7(4H)-one | CHEMBL505210
TypeSmall organic molecule
Emp. Form.C19H14ClN3O
Mol. Mass.335.787
SMILESClc1ccc(cc1)-c1c[nH]n2c1nc(Cc1ccccc1)cc2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: