Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose-5-phosphate synthase
LigandBDBM50263344
Substrate/Competitorn/a
Meas. Tech.ChEMBL_535725
IC50>200000±n/a nM
Citation Mao JEoh HHe RWang YWan BFranzblau SGCrick DCKozikowski AP Structure-activity relationships of compounds targeting mycobacterium tuberculosis 1-deoxy-D-xylulose 5-phosphate synthase. Bioorg Med Chem Lett 18:5320-3 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxy-D-xylulose-5-phosphate synthase
Name:1-deoxy-D-xylulose-5-phosphate synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:67882.02
Organism:Mycobacterium tuberculosis
Description:ChEMBL_1441273
Residue:638
Sequence:
MLQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDS
PHDPIIFDTGHQAYVHKMLTGRSQDFATLRKKGGLSGYPSRAESEHDWVESSHASAALSY
ADGLAKAFELTGHRNRHVVAVVGDGALTGGMCWEALNNIAASRRPVIIVVNDNGRSYAPT
IGGVADHLATLRLQPAYEQALETGRDLVRAVPLVGGLWFRFLHSVKAGIKDSLSPQLLFT
DLGLKYVGPVDGHDERAVEVALRSARRFGAPVIVHVVTRKGMGYPPAEADQAEQMHSTVP
IDPATGQATKVAGPGWTATFSDALIGYAQKRRDIVAITAAMPGPTGLTAFGQRFPDRLFD
VGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQIMMDVALHKLPVTMVLDRAGITG
SDGASHNGMWDLSMLGIVPGIRVAAPRDATRLREELGEALDVDDGPTALRFPKGDVGEDI
SALERRGGVDVLAAPADGLNHDVLLVAIGAFAPMALAVAKRLHNQGIGVTVIDPRWVLPV
SDGVRELAVQHKLLVTLEDNGVNGGAGSAVSAALRRAEIDVPCRDVGLPQEFYEHASRSE
VLADLGLTDQDVARRITGWVAALGTGVCASDAIPEHLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50263344
n/a
NameBDBM50263344
Synonyms:3,5-Bis-(4-chloro-phenyl)-7-trifluoromethyl-pyrazolo[1,5-a]pyrimidine | CHEMBL514373
TypeSmall organic molecule
Emp. Form.C19H10Cl2F3N3
Mol. Mass.408.204
SMILESFC(F)(F)c1cc(nc2c(cnn12)-c1ccc(Cl)cc1)-c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: