Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose-5-phosphate synthase
LigandBDBM50264037
Substrate/Competitorn/a
Meas. Tech.ChEMBL_535725
IC50 41400±n/a nM
Citation Mao JEoh HHe RWang YWan BFranzblau SGCrick DCKozikowski AP Structure-activity relationships of compounds targeting mycobacterium tuberculosis 1-deoxy-D-xylulose 5-phosphate synthase. Bioorg Med Chem Lett 18:5320-3 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxy-D-xylulose-5-phosphate synthase
Name:1-deoxy-D-xylulose-5-phosphate synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:67882.02
Organism:Mycobacterium tuberculosis
Description:ChEMBL_1441273
Residue:638
Sequence:
MLQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDS
PHDPIIFDTGHQAYVHKMLTGRSQDFATLRKKGGLSGYPSRAESEHDWVESSHASAALSY
ADGLAKAFELTGHRNRHVVAVVGDGALTGGMCWEALNNIAASRRPVIIVVNDNGRSYAPT
IGGVADHLATLRLQPAYEQALETGRDLVRAVPLVGGLWFRFLHSVKAGIKDSLSPQLLFT
DLGLKYVGPVDGHDERAVEVALRSARRFGAPVIVHVVTRKGMGYPPAEADQAEQMHSTVP
IDPATGQATKVAGPGWTATFSDALIGYAQKRRDIVAITAAMPGPTGLTAFGQRFPDRLFD
VGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQIMMDVALHKLPVTMVLDRAGITG
SDGASHNGMWDLSMLGIVPGIRVAAPRDATRLREELGEALDVDDGPTALRFPKGDVGEDI
SALERRGGVDVLAAPADGLNHDVLLVAIGAFAPMALAVAKRLHNQGIGVTVIDPRWVLPV
SDGVRELAVQHKLLVTLEDNGVNGGAGSAVSAALRRAEIDVPCRDVGLPQEFYEHASRSE
VLADLGLTDQDVARRITGWVAALGTGVCASDAIPEHLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50264037
n/a
NameBDBM50264037
Synonyms:3-(4-chlorophenyl)-5-((4-chlorophenylthio)methyl)-2-methylpyrazolo[1,5-a]pyrimidin-7(4H)-one | CHEMBL521592
TypeSmall organic molecule
Emp. Form.C20H15Cl2N3OS
Mol. Mass.416.324
SMILESCc1[nH]n2c(nc(CSc3ccc(Cl)cc3)cc2=O)c1-c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: