Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFarnesyl diphosphate synthase
LigandBDBM50240448
Substrate/Competitorn/a
Meas. Tech.ChEMBL_497104
IC50 44000±n/a nM
Citation Song YChan JMTovian ZSecrest ANagy EKrysiak KBergan KParniak MAOldfield E Bisphosphonate inhibitors of ATP-mediated HIV-1 reverse transcriptase catalyzed excision of chain-terminating 3'-azido, 3'-deoxythymidine: a QSAR investigation. Bioorg Med Chem 16:8959-67 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Farnesyl diphosphate synthase
Name:Farnesyl diphosphate synthase
Synonyms:Dimethylallyltranstransferase | FPP synthase | FPP synthetase | FPS | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | P14324
Type:Enzyme
Mol. Mass.:48272.89
Organism:Homo sapiens (Human)
Description:P14324
Residue:419
Sequence:
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240448
n/a
NameBDBM50240448
Synonyms:2-(3,4-dichlorophenyl)-1-hydroxyethane-1,1-diyldiphosphonic acid | CHEMBL34249 | [2-(3,4-Dichloro-phenyl)-1-hydroxy-1-phosphono-ethyl]-phosphonic acid
TypeSmall organic molecule
Emp. Form.C8H10Cl2O7P2
Mol. Mass.351.014
SMILESOC(Cc1ccc(Cl)c(Cl)c1)(P(O)(O)=O)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: