Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
LigandBDBM26806
Substrate/Competitorn/a
Meas. Tech.ChEMBL_492652
Ki 6700±n/a nM
Citation Georgiadis DYiotakis A Specific targeting of metzincin family members with small-molecule inhibitors: progress toward a multifarious challenge. Bioorg Med Chem 16:8781-94 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Name:A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Synonyms:Aggrecanase-1 | Metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Type:Enzyme
Mol. Mass.:90214.54
Organism:Homo sapiens (Human)
Description:O75173
Residue:837
Sequence:
MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEE
IVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHI
LRRKSPASGQGPMCNVKAPLGSPSPRPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGNP
GHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQP
LTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26806
n/a
NameBDBM26806
Synonyms:(3R,4R)-3-N-hydroxy-4-N-(4-{[2-(trifluoromethyl)-1H-1,3-benzodiazol-1-yl]methyl}benzene)oxane-3,4-diamido | CHEMBL253275 | benzimidazole analog., 32
TypeSmall organic molecule
Emp. Form.C22H21F3N4O4
Mol. Mass.462.4217
SMILESONC(=O)[C@H]1COCC[C@H]1NC(=O)c1ccc(Cn2c(nc3ccccc23)C(F)(F)F)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: