| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Heme oxygenase 1 |
|---|
| Ligand | BDBM50252801 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_539041 (CHEMBL1035715) |
|---|
| IC50 | 3000±n/a nM |
|---|
| Citation |  Rahman, MN; Vlahakis, JZ; Szarek, WA; Nakatsu, K; Jia, Z X-ray crystal structure of human heme oxygenase-1 in complex with 1-(adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone: a common binding mode for imidazole-based heme oxygenase-1 inhibitors. J Med Chem51:5943-52 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Heme oxygenase 1 |
|---|
| Name: | Heme oxygenase 1 |
|---|
| Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33005.15 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
|---|
| Residue: | 289 |
|---|
| Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
|---|
| BDBM50252801 |
|---|
| n/a |
|---|
| Name | BDBM50252801 |
|---|
| Synonyms: | 1-(adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone hydrochloride | CHEMBL493448 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H20N2O |
|---|
| Mol. Mass. | 244.3321 |
|---|
| SMILES | O=C(Cn1ccnc1)C12CC3CC(CC(C3)C1)C2 |TLB:1:8:11.10.15:13,THB:1:8:11:15.14.13,9:10:13:17.8.16,9:8:11.10.15:13,16:8:11:15.14.13,16:14:11:17.9.8| |
|---|
| Structure | 
|
|---|
Search and Browse
