Reaction Details |
| Report a problem with these data |
Target | Heme oxygenase 1 |
---|
Ligand | BDBM50252801 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_539041 (CHEMBL1035715) |
---|
IC50 | 3000±n/a nM |
---|
Citation | Rahman, MN; Vlahakis, JZ; Szarek, WA; Nakatsu, K; Jia, Z X-ray crystal structure of human heme oxygenase-1 in complex with 1-(adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone: a common binding mode for imidazole-based heme oxygenase-1 inhibitors. J Med Chem51:5943-52 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Heme oxygenase 1 |
---|
Name: | Heme oxygenase 1 |
Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
Type: | Enzyme |
Mol. Mass.: | 33005.15 |
Organism: | Rattus norvegicus (rat) |
Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
Residue: | 289 |
Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
BDBM50252801 |
---|
n/a |
---|
Name | BDBM50252801 |
Synonyms: | 1-(adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone hydrochloride | CHEMBL493448 |
Type | Small organic molecule |
Emp. Form. | C15H20N2O |
Mol. Mass. | 244.3321 |
SMILES | O=C(Cn1ccnc1)C12CC3CC(CC(C3)C1)C2 |TLB:1:8:11.10.15:13,THB:1:8:11:15.14.13,9:10:13:17.8.16,9:8:11.10.15:13,16:8:11:15.14.13,16:14:11:17.9.8| |
Structure |
|