Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-A2
LigandBDBM50246253
Substrate/Competitorn/a
Meas. Tech.ChEMBL_536590
IC50 45±n/a nM
Citation Anderson MAndrews DMBarker AJBrassington CABreed JByth KFCulshaw JDFinlay MRFisher EMcMiken HHGreen CPHeaton DWNash IANewcombe NJOakes SEPauptit RARoberts AStanway JJThomas APTucker JAWalker MWeir HM Imidazoles: SAR and development of a potent class of cyclin-dependent kinase inhibitors. Bioorg Med Chem Lett 18:5487-92 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-A2
Name:Cyclin-A2
Synonyms:CCN1 | CCNA | CCNA1 | Cyclin A | Cyclin-A
Type:Enzyme Subunit
Mol. Mass.:48550.19
Organism:Homo sapiens (Human)
Description:n/a
Residue:432
Sequence:
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50246253
n/a
NameBDBM50246253
Synonyms:4-(1-isopropyl-2-methyl-1H-imidazol-5-yl)-N-(4-(methylsulfonyl)phenyl)pyrimidin-2-amine | AZD-5438 | CHEMBL488436
TypeSmall organic molecule
Emp. Form.C18H21N5O2S
Mol. Mass.371.457
SMILESCC(C)n1c(C)ncc1-c1ccnc(Nc2ccc(cc2)S(C)(=O)=O)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: