Reaction Details |
| Report a problem with these data |
Target | G1/S-specific cyclin-D3 |
---|
Ligand | BDBM50246253 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_536593 (CHEMBL988883) |
---|
IC50 | 21±n/a nM |
---|
Citation | Anderson, M; Andrews, DM; Barker, AJ; Brassington, CA; Breed, J; Byth, KF; Culshaw, JD; Finlay, MR; Fisher, E; McMiken, HH; Green, CP; Heaton, DW; Nash, IA; Newcombe, NJ; Oakes, SE; Pauptit, RA; Roberts, A; Stanway, JJ; Thomas, AP; Tucker, JA; Walker, M; Weir, HM Imidazoles: SAR and development of a potent class of cyclin-dependent kinase inhibitors. Bioorg Med Chem Lett18:5487-92 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G1/S-specific cyclin-D3 |
---|
Name: | G1/S-specific cyclin-D3 |
Synonyms: | CCND3 | CCND3_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 32521.90 |
Organism: | Homo sapiens (Human) |
Description: | P30281 |
Residue: | 292 |
Sequence: | MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
|
|
|
BDBM50246253 |
---|
n/a |
---|
Name | BDBM50246253 |
Synonyms: | 4-(1-isopropyl-2-methyl-1H-imidazol-5-yl)-N-(4-(methylsulfonyl)phenyl)pyrimidin-2-amine | AZD-5438 | CHEMBL488436 |
Type | Small organic molecule |
Emp. Form. | C18H21N5O2S |
Mol. Mass. | 371.457 |
SMILES | CC(C)n1c(C)ncc1-c1ccnc(Nc2ccc(cc2)S(C)(=O)=O)n1 |
Structure |
|