Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoglyceride lipase (MGL)
LigandBDBM50274151
Substrate/Competitorn/a
Meas. Tech.ChEMBL_537181
Ki 58700±n/a nM
Citation Magrioti VNaxakis GHadjipavlou-Litina DMakriyannis AKokotos G A novel monoacylglycerol lipase inhibitor with analgesic and anti-inflammatory activity. Bioorg Med Chem Lett 18:5424-7 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoglyceride lipase (MGL)
Name:Monoglyceride lipase (MGL)
Synonyms:MAGL | Monoacylglycerol lipase | Monoglyceride lipase
Type:Enzyme
Mol. Mass.:33505.38
Organism:Rattus norvegicus (Rat)
Description:Q8R431
Residue:303
Sequence:
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVNTVQKDYPEVPVFLLG
HSMGGAISILAAAERPTHFSGMILISPLILANPESASTLKVLAAKLLNFVLPNISLGRID
SSVLSRNKSEVDLYNSDPLICHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSPSQDKTLKMYEGAYHVLHKELPEVTNSVLHEINTWVSHRIAVAGAR
CLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50274151
n/a
NameBDBM50274151
Synonyms:CHEMBL473249 | hexadecane-1,2-diamine dihydrochloride
TypeSmall organic molecule
Emp. Form.C16H36N2
Mol. Mass.256.4704
SMILESCCCCCCCCCCCCCCC(N)CN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: