Reaction Details |
| Report a problem with these data |
Target | Bcl2-associated agonist of cell death |
---|
Ligand | BDBM50274315 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_537289 (CHEMBL985385) |
---|
Ki | 14±n/a nM |
---|
Citation | Park, CM; Bruncko, M; Adickes, J; Bauch, J; Ding, H; Kunzer, A; Marsh, KC; Nimmer, P; Shoemaker, AR; Song, X; Tahir, SK; Tse, C; Wang, X; Wendt, MD; Yang, X; Zhang, H; Fesik, SW; Rosenberg, SH; Elmore, SW Discovery of an orally bioavailable small molecule inhibitor of prosurvival B-cell lymphoma 2 proteins. J Med Chem51:6902-15 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl2-associated agonist of cell death |
---|
Name: | Bcl2-associated agonist of cell death |
Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | Bcl-2-binding component 6 | Bcl-2-like protein 8 | Bcl-XL/Bcl-2-associated death promoter | Bcl2 antagonist of cell death | Bcl2-L-8 | Bcl2-antagonist of cell death (BAD) |
Type: | PROTEIN |
Mol. Mass.: | 18393.69 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_478760 |
Residue: | 168 |
Sequence: | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
|
|
|
BDBM50274315 |
---|
n/a |
---|
Name | BDBM50274315 |
Synonyms: | (R)-4-(4-((4'-Chlorobiphenyl-2-yl)methyl)piperazin-1-yl)-N-(4-(4-(dimethylamino)-1-(phenylthio)butan-2-ylamino)phenylsulfonyl)benzamide | CHEMBL508864 |
Type | Small organic molecule |
Emp. Form. | C42H46ClN5O3S2 |
Mol. Mass. | 768.429 |
SMILES | CN(C)CC[C@H](CSc1ccccc1)Nc1ccc(cc1)S(=O)(=O)NC(=O)c1ccc(cc1)N1CCN(Cc2ccccc2-c2ccc(Cl)cc2)CC1 |r| |
Structure |
|