Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50246525
Substrate/Competitorn/a
Meas. Tech.ChEMBL_558114
EC50>25000±n/a nM
Citation Martres PFaucher NLaroze APineau OFouchet MHPotvain FGrillot DBeneton V The discovery of equipotent PPARalpha/gamma dual activators. Bioorg Med Chem Lett 18:6251-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor delta
Synonyms:NUC1 | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR-beta | PPAR-delta
Type:PROTEIN
Mol. Mass.:49719.14
Organism:Mus musculus
Description:ChEMBL_1288931
Residue:440
Sequence:
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50246525
n/a
NameBDBM50246525
Synonyms:2-(4-((5-(4-tert-butylphenyl)-1-methyl-1H-pyrazole-3-carboxamido)methyl)-2-methylphenoxy)-2-methylpropanoic acid | CHEMBL518348
TypeSmall organic molecule
Emp. Form.C27H33N3O4
Mol. Mass.463.5686
SMILESCc1cc(CNC(=O)c2cc(-c3ccc(cc3)C(C)(C)C)n(C)n2)ccc1OC(C)(C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: