Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM50275363
Substrate/Competitorn/a
Meas. Tech.ChEMBL_493106
IC50 7±n/a nM
Citation Methot JLHamblett CLMampreian DMJung JHarsch ASzewczak AADahlberg WKMiddleton REHughes BFleming JCWang HKral AMOzerova NCruz JCHaines BChenard MKenific CMSecrist JPMiller TA SAR profiles of spirocyclic nicotinamide derived selective HDAC1/HDAC2 inhibitors (SHI-1:2). Bioorg Med Chem Lett 18:6104-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Q13547
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50275363
n/a
NameBDBM50275363
Synonyms:CHEMBL486152 | N-(2-amino-5-(thiophen-2-yl)phenyl)-6-(2-oxo-1,3,8-triazaspiro[4.5]decan-8-yl)nicotinamide
TypeSmall organic molecule
Emp. Form.C23H24N6O2S
Mol. Mass.448.541
SMILESNc1ccc(cc1NC(=O)c1ccc(nc1)N1CCC2(CNC(=O)N2)CC1)-c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: