Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine oxidase
LigandBDBM50273528
Substrate/Competitorn/a
Meas. Tech.ChEMBL_536002
Ki 100±n/a nM
Citation La Regina GSilvestri RGatti VLavecchia ANovellino EBefani OTurini PAgostinelli E Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B. Bioorg Med Chem 16:9729-40 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine oxidase
Name:Monoamine oxidase
Synonyms:Amine oxidase [flavin-containing] B | MAO-B | Monoamine oxidase B | Monoamine oxidase type B
Type:PROTEIN
Mol. Mass.:58428.94
Organism:Bos taurus
Description:ChEMBL_1501478
Residue:520
Sequence:
MSSKCDVVVVGGGISGMAAAKLLHDSGLNVIVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNHILRLSKELGLETYKVNEVERLIHHTKGKSYPFRGSFPSVWNPITYLDHNNLWR
TMDDMGREIPSDAPWKAPLAEQWDLMTMKELLDKICWTESSKQLAILFVNLCVTAEIHEV
SALWFLWYVKQCGGTTRIFSTSNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIHIDQ
TGENVLVETLNHELYEAKYVISAVPPVLGMKIHFNPPLPMMRNQLITRVPLGSVIKSIVY
YKEPFWRNMDYCGSMIIEGEEAPVAYALDDTKPDGSYPAIIGFILAHKARKLARLTKEER
LKKLCDLYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTSYFPPGIMTQYGRVLRQPVGR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWLPEPESVDVPAKPITTT
FLQRHLPSVPGLLKLIGLTTIFSATALGFLAHKRGLLVRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50273528
n/a
NameBDBM50273528
Synonyms:CHEMBL460608 | N-Methyl,N-(2-phenylethyl)-1H-indole-2-carboxamide
TypeSmall organic molecule
Emp. Form.C18H18N2O
Mol. Mass.278.3483
SMILESCN(CCc1ccccc1)C(=O)c1cc2ccccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: