Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyroid hormone receptor
LigandBDBM18869
Substrate/Competitorn/a
Meas. Tech.ChEMBL_493724
Ki 7.79±n/a nM
Citation Boyer SHJiang HJacintho JDReddy MVLi HLi WGodwin JLSchulz WGCable EEHou JWu RFujitaki JMHecker SJErion MD Synthesis and biological evaluation of a series of liver-selective phosphonic acid thyroid hormone receptor agonists and their prodrugs. J Med Chem 51:7075-93 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thyroid hormone receptor
Name:Thyroid hormone receptor
Synonyms:C-erbA-alpha | EAR-7 | EAR7 | Nuclear receptor subfamily 1 group A member 1 | Thyroid Hormone Receptor (TR-alpha) | Thyroid hormone receptor | Thyroid hormone receptor alpha | c-erbA-1
Type:Receptor
Mol. Mass.:54818.00
Organism:Homo sapiens (Human)
Description:Recombinant hThR was obtained from nuclear extracts from SF9 cells infected with baculovirus vectors encoding for ThRalpha 1.
Residue:490
Sequence:
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC
EDLAGNAASP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18869
n/a
NameBDBM18869
Synonyms:2-{3,5-dichloro-4-[4-hydroxy-3-(propan-2-yl)phenoxy]phenyl}acetic acid | CHEMBL41036 | KB-141
TypeSmall organic molecule
Emp. Form.C17H16Cl2O4
Mol. Mass.355.213
SMILESCC(C)c1cc(Oc2c(Cl)cc(CC(O)=O)cc2Cl)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: