Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase-like 1
LigandBDBM50246396
Substrate/Competitorn/a
Meas. Tech.ChEMBL_558916
IC50 60±n/a nM
Citation Jones CDAndrews DMBarker AJBlades KByth KFFinlay MRGeh CGreen CPJohannsen MWalker MWeir HM Imidazole pyrimidine amides as potent, orally bioavailable cyclin-dependent kinase inhibitors. Bioorg Med Chem Lett 18:6486-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase-like 1
Name:Cyclin-dependent kinase-like 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41689.97
Organism:Homo sapiens (Human)
Description:ChEMBL_774421
Residue:357
Sequence:
MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKH
PNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKH
NCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYG
PPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKI
PDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEH
NKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50246396
n/a
NameBDBM50246396
Synonyms:2-fluoro-4-(4-(1-isopropyl-2-methyl-1H-imidazol-5-yl)pyrimidin-2-ylamino)-N-methylbenzamide | CHEMBL455428
TypeSmall organic molecule
Emp. Form.C19H21FN6O
Mol. Mass.368.408
SMILESCNC(=O)c1ccc(Nc2nccc(n2)-c2cnc(C)n2C(C)C)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: