Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50254632
Substrate/Competitorn/a
Meas. Tech.ChEMBL_560708
Ki 1210±n/a nM
Citation Cole AGMetzger ABrescia MRQin LYAppell KCBrain CTHallett AGanju PDenholm AAWareing JRRitchie TJDrake GMBevan SJMacGloinn AMcBryde APatel VOakley PJNunez XGstach HSchneider PBaldwin JJDolle REMcDonald EHenderson I Sulfonamido-aryl ethers as bradykinin B1 receptor antagonists. Bioorg Med Chem Lett 19:119-22 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50254632
n/a
NameBDBM50254632
Synonyms:2-(2,4-dichloro-N-(2-(2,3-dihydro-1H-inden-5-yloxy)ethyl)phenylsulfonamido)-N-(3-methoxypropyl)acetamide | CHEMBL480203
TypeSmall organic molecule
Emp. Form.C23H28Cl2N2O5S
Mol. Mass.515.45
SMILESCOCCCNC(=O)CN(CCOc1ccc2CCCc2c1)S(=O)(=O)c1ccc(Cl)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: