Reaction Details |
| Report a problem with these data |
Target | Tumor necrosis factor receptor superfamily member 1A |
---|
Ligand | BDBM50255012 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_558470 (CHEMBL963876) |
---|
IC50 | 2000±n/a nM |
---|
Citation | Tecle, H; Shao, J; Li, Y; Kothe, M; Kazmirski, S; Penzotti, J; Ding, YH; Ohren, J; Moshinsky, D; Coli, R; Jhawar, N; Bora, E; Jacques-O'Hagan, S; Wu, J Beyond the MEK-pocket: can current MEK kinase inhibitors be utilized to synthesize novel type III NCKIs? Does the MEK-pocket exist in kinases other than MEK? Bioorg Med Chem Lett19:226-9 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor receptor superfamily member 1A |
---|
Name: | Tumor necrosis factor receptor superfamily member 1A |
Synonyms: | CD_antigen=CD120a | TBPI | TNF-R1 | TNF-RI | TNFAR | TNFR-I | TNFR1 | TNFRSF1A | TNR1A_HUMAN | Tumor necrosis factor receptor R1 | Tumor necrosis factor receptor superfamily member 1A | Tumor necrosis factor receptor superfamily member 1A, membrane form | Tumor necrosis factor-binding protein 1 | p55 | p60 |
Type: | PROTEIN |
Mol. Mass.: | 50495.39 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1509419 |
Residue: | 455 |
Sequence: | MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
|
|
|
BDBM50255012 |
---|
n/a |
---|
Name | BDBM50255012 |
Synonyms: | 5-((4-(methylsulfonyl)benzylamino)methyl)-3,4-difluoro-2-(2-fluoro-4-iodophenylamino)benzoic acid | CHEMBL465465 |
Type | Small organic molecule |
Emp. Form. | C22H18F3IN2O4S |
Mol. Mass. | 590.354 |
SMILES | CS(=O)(=O)c1ccc(CNCc2cc(C(O)=O)c(Nc3ccc(I)cc3F)c(F)c2F)cc1 |
Structure |
|