Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor
LigandBDBM50254520
Substrate/Competitorn/a
Meas. Tech.ChEMBL_558515
IC50 2±n/a nM
Citation Zhou NZeller WKrohn MAnderson HZhang JOnua EKiselyov ASRamirez JHalldorsdottir GAndrésson TGurney MESingh J 3,4-Disubstituted indole acylsulfonamides: a novel series of potent and selective human EP3 receptor antagonists. Bioorg Med Chem Lett 19:123-6 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor, EP3 subtype | PGE2-R | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor
Type:Enzyme
Mol. Mass.:43335.03
Organism:Homo sapiens (Human)
Description:P43115
Residue:390
Sequence:
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50254520
n/a
NameBDBM50254520
Synonyms:CHEMBL466184 | N-(3,4-difluorophenylsulfonyl)-2-(3-(naphthalen-2-ylthio)-1H-indol-4-yloxy)acetamide
TypeSmall organic molecule
Emp. Form.C26H18F2N2O4S2
Mol. Mass.524.559
SMILESFc1ccc(cc1F)S(=O)(=O)NC(=O)COc1cccc2[nH]cc(Sc3ccc4ccccc4c3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: