Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Yes
LigandBDBM26145
Substrate/Competitorn/a
Meas. Tech.ChEMBL_537094
Kd 1±n/a nM
Citation Bamborough PDrewry DHarper GSmith GKSchneider K Assessment of chemical coverage of kinome space and its implications for kinase drug discovery. J Med Chem 51:7898-914 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Yes
Name:SRC
Synonyms:Proto-oncogene c-Yes | YES1 | p61-yes
Type:Protein
Mol. Mass.:60801.54
Organism:Homo sapiens (Human)
Description:P07947
Residue:543
Sequence:
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26145
n/a
NameBDBM26145
Synonyms:2,4-dianilino pyrimidine, 2 | 3-({4-[(5-hydroxy-2-methylphenyl)amino]pyrimidin-2-yl}amino)benzamide | CHEMBL249097
TypeSmall organic molecule
Emp. Form.C18H17N5O2
Mol. Mass.335.3599
SMILESCc1ccc(O)cc1Nc1ccnc(Nc2cccc(c2)C(N)=O)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: