| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50279464 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_545004 (CHEMBL1014639) |
|---|
| Ki | 1600±n/a nM |
|---|
| Citation |  Bansal, R; Kumar, G; Gandhi, D; Young, LC; Harvey, AL Synthesis of a series of 8-(substituted-phenyl)xanthines and a study on the effects of substitution pattern of phenyl substituents on affinity for adenosine A(1) and A(2A) receptors. Eur J Med Chem44:2122-7 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM50279464 |
|---|
| n/a |
|---|
| Name | BDBM50279464 |
|---|
| Synonyms: | 1,3-Dimethyl-8-[3-(2-pyrrolidin-1-ylethoxy)-phenyl]xanthine | CHEMBL486316 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23N5O3 |
|---|
| Mol. Mass. | 369.4176 |
|---|
| SMILES | Cn1c2nc([nH]c2c(=O)n(C)c1=O)-c1cccc(OCCN2CCCC2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
