Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBaculoviral IAP repeat-containing protein 2
LigandBDBM50273673
Substrate/Competitorn/a
Meas. Tech.ChEMBL_538134
Ki 1.2±n/a nM
Citation Peng YSun HNikolovska-Coleska ZQiu SYang CYLu JCai QYi HKang SYang DWang S Potent, orally bioavailable diazabicyclic small-molecule mimetics of second mitochondria-derived activator of caspases. J Med Chem 51:8158-62 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Baculoviral IAP repeat-containing protein 2
Name:Baculoviral IAP repeat-containing protein 2
Synonyms:Baculoviral IAP repeat-containing protein 2 (cIAP1) | Cellular inhibitor of apoptosis 1 | Inhibitor of apoptosis protein 2 (cIAP1)
Type:Protein
Mol. Mass.:69900.47
Organism:Homo sapiens (Human)
Description:Q13490
Residue:618
Sequence:
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50273673
n/a
NameBDBM50273673
Synonyms:(5S,8S,10aR)-N-Benzhydryl-5-((S)-2-(methylamino)propanamido)-6-oxodeca-hydropyrrolo[1,2-a][1,5]diazocine-8-carboxamide | CHEMBL459541
TypeSmall organic molecule
Emp. Form.C27H35N5O3
Mol. Mass.477.5985
SMILESCN[C@@H](C)C(=O)N[C@H]1CNCC[C@H]2CC[C@H](N2C1=O)C(=O)NC(c1ccccc1)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: