| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50273416 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_561948 (CHEMBL1021466) |
|---|
| Ki | 2530±n/a nM |
|---|
| Citation |  Kurimura, M; Liu, H; Sulima, A; Hashimoto, A; Przybyl, AK; Ohshima, E; Kodato, S; Deschamps, JR; Dersch, CM; Rothman, RB; Lee, YS; Jacobson, AE; Rice, KC Probes for narcotic receptor mediated phenomena. 37. Synthesis and opioid binding affinity of the final pair of oxide-bridged phenylmorphans, the ortho- and para-b-isomers and their N-phenethyl analogues, and the synthesis of the N-phenethyl analogues of the ortho- and para-d-isomers. J Med Chem51:7866-81 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50273416 |
|---|
| n/a |
|---|
| Name | BDBM50273416 |
|---|
| Synonyms: | (3R*,6aS*,11aR*)-1,3,4,5,6,11a-Hexahydro-2-phenethyl-2H-3,6a-methanobenzofuro[2,3-c]azocin-10-ol | CHEMBL455906 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25NO2 |
|---|
| Mol. Mass. | 335.4394 |
|---|
| SMILES | Oc1ccc2O[C@H]3CN(CCc4ccccc4)[C@@H]4CCC[C@]3(C4)c2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
