Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50273933 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_561948 (CHEMBL1021466) |
---|
Ki | 4760±n/a nM |
---|
Citation | Kurimura, M; Liu, H; Sulima, A; Hashimoto, A; Przybyl, AK; Ohshima, E; Kodato, S; Deschamps, JR; Dersch, CM; Rothman, RB; Lee, YS; Jacobson, AE; Rice, KC Probes for narcotic receptor mediated phenomena. 37. Synthesis and opioid binding affinity of the final pair of oxide-bridged phenylmorphans, the ortho- and para-b-isomers and their N-phenethyl analogues, and the synthesis of the N-phenethyl analogues of the ortho- and para-d-isomers. J Med Chem51:7866-81 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50273933 |
---|
n/a |
---|
Name | BDBM50273933 |
Synonyms: | (4R*,6aS*,11bR*)-2,3,4,5,6,6a-Hexahydro-3-phenethyl-1H-4,11b-methanobenzofuro[3,2-d]azocine-10-ol | CHEMBL515681 |
Type | Small organic molecule |
Emp. Form. | C22H25NO2 |
Mol. Mass. | 335.4394 |
SMILES | Oc1ccc2O[C@@H]3CC[C@H]4C[C@@]3(CCN4CCc3ccccc3)c2c1 |r| |
Structure |
|