| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 4 |
|---|
| Ligand | BDBM50246732 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_557458 (CHEMBL962236) |
|---|
| IC50 | 5700±n/a nM |
|---|
| Citation |  Danilenko, VN; Simonov, AY; Lakatosh, SA; Kubbutat, MH; Totzke, F; Schächtele, C; Elizarov, SM; Bekker, OB; Printsevskaya, SS; Luzikov, YN; Reznikova, MI; Shtil, AA; Preobrazhenskaya, MN Search for inhibitors of bacterial and human protein kinases among derivatives of diazepines[1,4] annelated with maleimide and indole cycles. J Med Chem51:7731-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 4 |
|---|
| Name: | Cyclin-dependent kinase 4 |
|---|
| Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33731.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11802 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
|---|
| BDBM50246732 |
|---|
| n/a |
|---|
| Name | BDBM50246732 |
|---|
| Synonyms: | 3-(1,3-Dioxo-1,3,9b,10-tetrahydro-2H-indolo[1',7':4,5,6]pyrrolo[3',4':2,3][1,4] diazepino[1,7-a]indol-2-yl)propyl N-Methylimidothiocarbamate | CHEMBL447317 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23N5O2S |
|---|
| Mol. Mass. | 457.547 |
|---|
| SMILES | CNC(=N)SCCCN1C(=O)C2=C(C1=O)n1ccc3cccc(C4Cc5ccccc5N24)c13 |c:11| |
|---|
| Structure | 
|
|---|
Search and Browse
