| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RAC-alpha serine/threonine-protein kinase |
|---|
| Ligand | BDBM50246774 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_557453 (CHEMBL961569) |
|---|
| IC50 | 9000±n/a nM |
|---|
| Citation |  Danilenko, VN; Simonov, AY; Lakatosh, SA; Kubbutat, MH; Totzke, F; Schächtele, C; Elizarov, SM; Bekker, OB; Printsevskaya, SS; Luzikov, YN; Reznikova, MI; Shtil, AA; Preobrazhenskaya, MN Search for inhibitors of bacterial and human protein kinases among derivatives of diazepines[1,4] annelated with maleimide and indole cycles. J Med Chem51:7731-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RAC-alpha serine/threonine-protein kinase |
|---|
| Name: | RAC-alpha serine/threonine-protein kinase |
|---|
| Synonyms: | AKT phosphorylation (p-AKT) | AKT1 | AKT1/PPP1CA | AKT1_HUMAN | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 55681.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P31749 |
|---|
| Residue: | 480 |
|---|
| Sequence: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
|
|
|
|---|
| BDBM50246774 |
|---|
| n/a |
|---|
| Name | BDBM50246774 |
|---|
| Synonyms: | 3-(1,3-Dioxo-1,3-dihydro-2H-indolo[1',7':4,5,6]pyrrolo[3',4':2,3][1,4]diazepino[1,7-a]indol-2-yl)propyl Imidothiocarbamate | CHEMBL489083 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H19N5O2S |
|---|
| Mol. Mass. | 441.505 |
|---|
| SMILES | NC(=N)SCCCn1c(=O)c2c(n3c(cc4ccccc34)c3cccc4ccn2c34)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
